General Information

  • ID:  hor005434
  • Uniprot ID:  P16548
  • Protein name:  Accessory gland-specific peptide 95EF
  • Gene name:  Acp95EF
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  animal
  • Expression:  By mating. |In very late pupae and in adults. |Main cells of the accessory glands of males.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007610 behavior; GO:0019953 sexual reproduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AVLNPSSTAKPRFETKDRKLSAGALQSLAG
  • Length:  30
  • Propeptide:  MASVKLFFIAILVVALSLNTSAAVLNPSSTAKPRFETKDRKLSAGALQSLAG
  • Signal peptide:  MASVKLFFIAILVVALSLNTSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This protein may be a precursor of secreted proteins and peptide hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P16548-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005434_AF2.pdbhor005434_ESM.pdb

Physical Information

Mass: 363200 Formula: C135H229N41O43
Absent amino acids: CHIMWY Common amino acids: A
pI: 11.06 Basic residues: 5
Polar residues: 9 Hydrophobic residues: 11
Hydrophobicity: -40.33 Boman Index: -5531
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78.33
Instability Index: 3386 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2109712
  • Title:  Structure, cell-specific expression, and mating-induced regulation of a Drosophila melanogaster male accessory gland gene.